DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and dad-1

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_491889.1 Gene:dad-1 WormBaseID:WBGene00000896 Length:113 Species:Caenorhabditis elegans

Alignment Length:106 Identity:70/107 (65%)
Similarity:87/107 (81%) Gaps:0/107 (0%)


  Fly     7 VISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAVC 71
            |:||.::||.:.|..|||::|.|:.|||.|||.||:||.||||||||||||||||||:.||||.|
 Worm     8 VLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGFISTVTSFVLASC 72

  Fly    72 LRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
            ||:|.|.:|:|.|..:|.||.|||||||::||||||:||:|
 Worm    73 LRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 69/105 (66%)
dad-1NP_491889.1 DAD 8..113 CDD:280306 69/105 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227275292
eggNOG 1 0.900 E1_KOG1746
Hieranoid 1 1.000
Homologene 1 1.000 H1027
Inparanoid 1 1.050 152 1.000 Inparanoid score I2915
Isobase 1 0.950 0 Normalized mean entropy S554
OMA 1 1.010
OrthoDB 1 1.010 D1586516at2759
OrthoFinder 1 1.000 FOG0003847
OrthoInspector 1 1.000 T476166
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 LDO PTHR10705
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R877
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.