DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7781 and twit

Sequence 1:NP_001285745.1 Gene:CG7781 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster

Alignment Length:154 Identity:44/155 (28%)
Similarity:65/155 (42%) Gaps:40/155 (26%)


  Fly    11 ILAIAVQ-QGYAIKCFVCNSHKDANCALD----------IPPD-------NLLKDCDEQYSSRGK 57
            |.||..| |.:.::|:.|:|  |...|.|          ||.|       |||:.|:...:|..:
  Fly    22 ITAINEQHQKHHLQCWHCSS--DTIGAEDFCDVTFQEDNIPTDLIKERNINLLRSCNGTINSDHE 84

  Fly    58 GIPTYCRKITQIIEFSVNSLPPDSRVI--RTCAYQNQTS-TNYC-YQRAGFGGRQVVC-SCDTDN 117
              ...|||..:         ..:.::|  |.|.|.|::. ...| ........|::.| .|.||.
  Fly    85 --RAVCRKTVE---------ENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRIFCEDCLTDR 138

  Fly   118 CNGAGAMGASALGVAAMV---GLL 138
            ||||.| |||.|.:..::   ||:
  Fly   139 CNGALA-GASILEMLLLLPIAGLI 161



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33562
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.