DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7781 and F28A12.3

Sequence 1:NP_001285745.1 Gene:CG7781 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_505231.1 Gene:F28A12.3 WormBaseID:WBGene00017880 Length:160 Species:Caenorhabditis elegans

Alignment Length:143 Identity:35/144 (24%)
Similarity:60/144 (42%) Gaps:26/144 (18%)


  Fly     3 YIYVISALILAIAVQQGYAIKCFVCNSHKDAN-------CALDIPPDNLLKDCDEQYSSRGKGI- 59
            |.:..:.||..|.  ..|.::|..|...::.:       ..|:|.||....||.   ::.|..: 
 Worm     6 YFFFFAFLIFLIT--PTYPLQCHQCGGQENMSKLTKKMFTELNISPDKYYGDCK---ATSGADVC 65

  Fly    60 --PTYCRKITQIIEFSVNSLP-PDSRVIRTCAY----QNQTSTNYCY------QRAGFGGRQVVC 111
              .|:|.|..:|.....||:. ..:...:.||.    .|||.:|.|:      ::.|:...::.|
 Worm    66 TNGTFCIKRAKIHRVGFNSINFKWTSYTKGCASVREDNNQTPSNGCFDLNQKVKKTGYTTERLDC 130

  Fly   112 SCDTDNCNGAGAM 124
            .||.|.||.:.|:
 Worm   131 YCDKDFCNSSTAV 143



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4074
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.