DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7781 and K11H12.7

Sequence 1:NP_001285745.1 Gene:CG7781 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_499966.1 Gene:K11H12.7 WormBaseID:WBGene00019663 Length:127 Species:Caenorhabditis elegans

Alignment Length:125 Identity:29/126 (23%)
Similarity:51/126 (40%) Gaps:22/126 (17%)


  Fly     1 MQYIYVISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPDNLLKDCDEQYSSRGKGI-PTYCR 64
            |:::.|.::|....|     |:.|::|||.....|..:....|  |.|..:.....|.: |..||
 Worm     1 MRFLIVFASLFAVSA-----ALNCYICNSLNQPECVHNYEKFN--KICPVKSFGGMKSVKPLGCR 58

  Fly    65 KITQIIEFSVNSLPPDSRVIRTCAYQN---QTSTNYCYQRAGFGGRQVVCSCDTDNCNGA 121
            ...|.::       .::.::|.|||..   :..:|    :...|..:|...|..:.||.|
 Worm    59 VSRQYVK-------EETSIVRECAYTGEDIERKSN----KGSLGVSRVYSQCSENLCNSA 107



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98068
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33562
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.