DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and Rabif

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_663485.1 Gene:Rabif MGIID:2138605 Length:123 Species:Mus musculus

Alignment Length:111 Identity:47/112 (42%)
Similarity:71/112 (63%) Gaps:4/112 (4%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLVKDMMTF 75
            :|:|:..|.||.|...:|:.....:::.::.:|.|.:|.| .||..|  .:.|::.|||.||.||
Mouse    14 EGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPD-LADGSNPDGDLLQEHWLVNDMFTF 77

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
Mouse    78 ENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 39/88 (44%)
RabifNP_663485.1 RabGEF 19..123 CDD:238150 45/105 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195843200
eggNOG 1 0.900 E1_KOG4113
Hieranoid 1 1.000
Homologene 1 1.000 H37702
Inparanoid 1 1.050 92 1.000 Inparanoid score I5046
Isobase 1 0.950 0 Normalized mean entropy S4823
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 1 1.000 T1084500
orthoMCL 1 0.900 OOG5_132853
Panther 1 1.100 LDO PTHR13276
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R754
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.