DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and DSS4

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_015342.1 Gene:DSS4 SGDID:S000006221 Length:143 Species:Saccharomyces cerevisiae

Alignment Length:119 Identity:28/120 (23%)
Similarity:49/120 (41%) Gaps:42/120 (35%)


  Fly    18 SNVRCQF--CNCLMLKAQEGTYNQEE-VDVPLMTQK-----QDRT-ADSLNSEPLKDFWLVKDMM 73
            |...|.|  |:..::     |.|.:. :::|.....     ::|| .|:..||  .:|.:|.|:.
Yeast     2 SKATCSFEGCHSAVI-----TINDDNIINLPEQVHSEFKLLENRTMRDATPSE--SNFLVVPDVW 59

  Fly    74 TFENIGFSNTVDGR--------------------------KFLVCADCERGPVG 101
            .|:|:|.|..:...                          |:|:||||::||:|
Yeast    60 DFDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIG 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 24/102 (24%)
DSS4NP_015342.1 RabGEF 2..136 CDD:238150 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.