DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and RGD1563962

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_003749349.1 Gene:RGD1563962 RGDID:1563962 Length:123 Species:Rattus norvegicus

Alignment Length:111 Identity:45/112 (40%)
Similarity:69/112 (62%) Gaps:4/112 (4%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLVKDMMTF 75
            :|:|:..|.||.|...:|:.....:::.::.:|.|.:|.| ..|..|  .:.|::.|||.||..|
  Rat    14 EGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPD-LVDGSNPDGDVLEEHWLVNDMFIF 77

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
  Rat    78 ENVGFTKDVGNVKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 37/88 (42%)
RGD1563962XP_003749349.1 RabGEF 19..123 CDD:238150 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195843241
eggNOG 1 0.900 E1_KOG4113
Hieranoid 1 1.000
Homologene 1 1.000 H37702
Inparanoid 1 1.050 89 1.000 Inparanoid score I4969
OMA 1 1.010
OrthoDB 1 1.010 D1495679at2759
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 1 1.000 T1088048
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.