DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and rabif

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001002511.1 Gene:rabif ZFINID:ZDB-GENE-040718-216 Length:132 Species:Danio rerio

Alignment Length:111 Identity:45/112 (40%)
Similarity:66/112 (59%) Gaps:3/112 (3%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQD--RTADSLNSEPLKDFWLVKDMMTF 75
            ||||...|.||.|...:|......:.::|:.:|.|.:|..  ::..:|:.:.|...|||.||.||
Zfish    22 DGKNVKAVLCQRCGSKVLCPGMAVFAEKELFLPSMRKKTSIGQSDGTLDGDTLMAHWLVDDMYTF 86

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|:|:|||||.||:|:|.|..:.. |:||.||.|:
Zfish    87 ENVGFTKDVGKVKYLICADCEIGPIGWHCLDDKKSFYVALDRVNHE 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 35/88 (40%)
rabifNP_001002511.1 Mss4 43..131 CDD:282300 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195844747
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37702
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1495679at2759
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13276
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R754
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.