DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and mdt-9

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001255737.1 Gene:mdt-9 WormBaseID:WBGene00014938 Length:147 Species:Caenorhabditis elegans

Alignment Length:103 Identity:41/104 (39%)
Similarity:65/104 (63%) Gaps:3/104 (3%)


  Fly    16 NKSNVRCQFC-NCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLNSEPLKDFWLVKDMMTFENIG 79
            |:|...|:.| ..::||.....|..||.|:||..||  :..|...:||::.|:.||||..|||:|
 Worm    32 NESTYICKICQTVVILKNMTTEYLDEERDLPLPRQK--KGIDHTQTEPIRGFFGVKDMFAFENVG 94

  Fly    80 FSNTVDGRKFLVCADCERGPVGYHDLSTRHCYLALKRV 117
            |:.:.:|:::|||.:||:||||:.|..|...|::.:|:
 Worm    95 FTRSSEGKRYLVCGECEQGPVGFVDPVTEMNYVSPERL 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 35/85 (41%)
mdt-9NP_001255737.1 Mss4 51..134 CDD:282300 35/85 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.