DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and ZK970.8

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001022541.1 Gene:ZK970.8 WormBaseID:WBGene00014174 Length:143 Species:Caenorhabditis elegans

Alignment Length:109 Identity:29/110 (26%)
Similarity:55/110 (50%) Gaps:5/110 (5%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQ-EGTYNQEEVDVPLMTQKQDRTADSLNSEPLKDFWLVKDMMTFE 76
            |.:|...|.|:.|..::.... ..|...:...:.:||.   :....|..|.:..:|..::.|.|:
 Worm    37 DDRNLHKVVCRRCKSVIFPEDVVMTVENQPYQLRVMTH---QAKGPLAQEKISWWWYTENDMIFD 98

  Fly    77 NIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHCYLALKRVVHK 120
            .:|: .|||.:|.|:|.|||.||:|:.....:..::|::||.::
 Worm    99 TVGW-QTVDKKKVLMCGDCELGPIGFRSEDNKKFWVAVERVKYE 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 24/85 (28%)
ZK970.8NP_001022541.1 Mss4 69..139 CDD:282300 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4823
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1495679at2759
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132853
Panther 1 1.100 O PTHR13276
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R754
TreeFam 1 0.960
87.850

Return to query results.
Submit another query.