DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and Rabif

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001007679.1 Gene:Rabif RGDID:1359331 Length:123 Species:Rattus norvegicus

Alignment Length:111 Identity:45/112 (40%)
Similarity:69/112 (62%) Gaps:4/112 (4%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLVKDMMTF 75
            :|:|:..|.||.|...:|:.....:::.::.:|.|.:|.| ..|..|  .:.|::.|||.||..|
  Rat    14 EGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPD-LVDGSNPDGDVLEEHWLVNDMFIF 77

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
  Rat    78 ENVGFTKDVGNVKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 37/88 (42%)
RabifNP_001007679.1 RabGEF 19..123 CDD:238150 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195843908
eggNOG 1 0.900 E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37702
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132853
Panther 1 1.100 LDO PTHR13276
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.