DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and SPBC4C3.04c

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_596302.1 Gene:SPBC4C3.04c PomBaseID:SPBC4C3.04c Length:100 Species:Schizosaccharomyces pombe

Alignment Length:104 Identity:37/105 (35%)
Similarity:56/105 (53%) Gaps:18/105 (17%)


  Fly    18 SNVR--CQFCNCLMLKAQEGTYNQEEVDV---PLMT-QKQDRTADSLNSEPLKDFWLVKDMMTFE 76
            ||:|  ||.|..::       :|.:..||   |.|: .....|.:.|.::   ||:|:||...|:
pombe     2 SNLRIVCQHCPSVV-------FNNKRPDVVKRPTMSAMLHSETQEDLETD---DFFLLKDPFAFD 56

  Fly    77 NIGFSNTV-DGRKFLVCADCERGPVGYHDLSTRHCYLAL 114
            |:..|..: :..|.|.|||||:||:||:| |..:.||.|
pombe    57 NVSVSKPLANNYKLLACADCEKGPLGYYD-SKNNEYLLL 94

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 31/87 (36%)
SPBC4C3.04cNP_596302.1 RabGEF 4..100 CDD:238150 35/103 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 1 1.000 T1125433
orthoMCL 1 0.900 OOG5_132853
Panther 1 1.100 LDO PTHR13276
Phylome 1 0.910 0.615 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R754
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.