DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: strat and rabif

Sequence 1:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_002939675.1 Gene:rabif XenbaseID:XB-GENE-1007675 Length:118 Species:Xenopus tropicalis

Alignment Length:110 Identity:50/111 (45%)
Similarity:69/111 (62%) Gaps:2/111 (2%)


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRT-ADSLNSEPLKDFWLVKDMMTFE 76
            ||||...|.||.|.|.:|.|...|..:.|:.:|.|.:|...: :.|.:.|.|.:.|||.||.|||
 Frog     9 DGKNSRAVLCQRCGCRVLSAGVATLAKRELLLPSMRKKSSLSESSSPDCELLAEHWLVHDMFTFE 73

  Fly    77 NIGFSNTVDGRKFLVCADCERGPVGYHDLSTR-HCYLALKRVVHK 120
            |:||:..|...|:|||||||.||:|:|.|..: :.|:||:||.|:
 Frog    74 NVGFTKDVGSIKYLVCADCEVGPIGWHSLEEKSNFYVALERVRHE 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 38/87 (44%)
rabifXP_002939675.1 Mss4 31..117 CDD:282300 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195843597
eggNOG 1 0.900 E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37702
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1495679at2759
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.