DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8086 and Nup98-96

Sequence 1:NP_001260237.1 Gene:CG8086 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001262885.1 Gene:Nup98-96 FlyBaseID:FBgn0039120 Length:1960 Species:Drosophila melanogaster

Alignment Length:1618 Identity:310/1619 (19%)
Similarity:463/1619 (29%) Gaps:519/1619 (32%)


  Fly   287 FGLKTK----HIQVSDTPAPGAYS-PEKS-----RLHSAPAYSIAGKASQDVVDCTPAPGAYEPE 341
            ||..|.    ....:...|.||:| |:::     ...:|.:.|:.|:::      .||.||.:|.
  Fly    73 FGANTSTGFGSTATAQPTAFGAFSQPQQTSNIFGSTQTAASTSLFGQST------LPAFGAAKPT 131

  Fly   342 KCVLSRTPAFS-----FGHRAELAKSSDTPAPGTYNPEKVRLDHTPAFTLSGRPETRSVSETPAP 401
            .....:|.|..     ||..|....::.....||..|....:..:...:...:|:..:|..:...
  Fly   132 MTAFGQTAAAQPTGSLFGQPAAATSTTGFGGFGTSAPTTTNVFGSGTASAFAQPQATAVGASGVN 196

  Fly   402 GSYAPEKYR-----------------NDRTPAFT----FGGK--HEQRLESSTPAPGDY-CPEKV 442
            ...|..||:                 |.:....|    |.||  .|.|||       || |..|.
  Fly   197 TGTAVAKYQPTIGTDTLMKSGQANSVNTKQHCITAMKEFEGKSLEELRLE-------DYMCGRKG 254

  Fly   443 RHDHNPAFSFAGRHDLHKPSDTPAPGAYDT----------EKVRQDH--------------NPAF 483
            ....|...:|.....:.:|:...:.|.:.:          :.|.::.              |.||
  Fly   255 PQAGNAPGAFGFGAQVTQPAQPASGGLFGSTAQPSTGLFGQTVTENKSMFGTTAFGQQPATNNAF 319

  Fly   484 SFAGRHD--LHK--------PSETPAPGAYSPEKVRQDHNPAFSMAGK--HSQKVTSDSPAPGDY 536
            ..|.:.:  |.|        |...||..|.:|...:    |||...|.  .....||.:||.|. 
  Fly   320 GAATQQNNFLQKPFGATTTTPFAAPAADASNPFGAK----PAFGQGGSLFGQAPATSAAPAFGQ- 379

  Fly   537 CPEKVRLDHTPAYSFGVKSDPKVENN----TPAPGDYHPEKVRQDHNPAYSFAGR-HDLQKPDNT 596
                   .:|....||..:....::.    |||.   .|.|.......|.|.|.. .....|..:
  Fly   380 -------TNTGFGGFGTTAGATQQSTLFGATPAA---DPNKSAFGLGTAASAATTGFGFGAPATS 434

  Fly   597 PAPGAYFPEKVRLDHNPAFSMAG-KYDAKVTNDTPAPGDYSPEKVRQDTNPAYSFAG--RHDLHK 658
            .|.|..|..|      ||.|.|. .:.|..|..||.      .....:|:.|.:..|  ...|:|
  Fly   435 TAGGGLFGNK------PATSFAAPTFGATSTASTPF------SNFGLNTSTAATGGGLFNSGLNK 487

  Fly   659 PSETPAPGAYSPEKVRLDHNPAFTMAGKHDQKILNGTPAPGD--YSPEKCRLDHTPA-------- 713
            |:.:...|..:.....|:.|     ||.....:...|..||.  :......|..|.|        
  Fly   488 PATSGFGGFGATSAAPLNFN-----AGNTGGSLFGNTAKPGGGLFGGGTTTLGGTGAAPTGGLFG 547

  Fly   714 ---YSFGGKN-----------------------DPKVENNTPAPGDYHPEKVRLDHNPAYSFAGR 752
               .||||..                       .|.:...||:....|.:.:....:|.......
  Fly   548 GGTTSFGGVGGSLGGGGFGMGTNNSLTGGIMGAQPTLGIMTPSHQPIHQQILARVTSPYGDSPIF 612

  Fly   753 HDLQKPSDTPAPGAYSPEKVRQDHNPAFSMAGKPVEKLTNGTPAPGDYSPEKVRLNHTPAYTFGG 817
            .||:..|:..|..|.:|..    ......:.....:..|:..|||.........||....:....
  Fly   613 KDLKLSSEADATRATNPAA----QQAVLDLTSNQYKISTSNNPAPMKVKALGSTLNRKSLFDGLE 673

  Fly   818 KNDPKVENNTPAPGDYH---PEKVR--QDHNPAFSFAGRHDLHKPNDTP--APGAYCPEKVRQDH 875
            :.|..||.....|....   ..||:  :..||:.|...     .|| ||  .|....|.|.|:  
  Fly   674 EFDASVEGFNLKPSAKRLVIKPKVKSVEGGNPSSSIGS-----APN-TPQSRPKGATPNKERE-- 730

  Fly   876 NPAFSMAGKYTQKVANDTPAPGDYSPEKVRLDHTPAYTFGGKNDPKVESNTPAPGDYHP---EKV 937
              :||.|      :.::...|...||             |..|..:.:.|.......||   |||
  Fly   731 --SFSGA------IPSEPLPPAGNSP-------------GATNGRESQDNGRRESWLHPNNLEKV 774

  Fly   938 RQDHNPAFSFAGRHNLQKPSDTPAP-----GAYSPEKVRQDHNPAFTMAGKHDPKVSNDTPAPGD 997
            ||           ||:|...|..:|     ....|.|....:.|:.|:      ::|..|.....
  Fly   775 RQ-----------HNIQTGMDQGSPHNSTLNELVPRKPLDTYRPSSTV------RLSVSTIPENP 822

  Fly   998 YSPEKVRLDYTPSFTFAGKNNPKVENDTPAPGDYHPEKVRQDHNPAFSFAGRHDLHKPSDTPAPG 1062
            :..:...:....:||....|...:.|.:....|....:.|.....|.:.|...:.|       |.
  Fly   823 FEDQSSTIARRETFTSQQANESVLSNRSNEAEDSAANQSRLAIEAAAAEAADDESH-------PT 880

  Fly  1063 AYSPEKVRQDHNPAFSMAGKYIEKITNGTPAPGDYCPEKVRLDHTPAFT----------FGGKND 1117
            .....:|.....|:......|:        |....|.       .|.||          ||.:.|
  Fly   881 GIVLRRVGYYTIPSLDDLRSYL--------AEDGSCV-------VPNFTVGREGYGNVFFGKEMD 930

  Fly  1118 --------------------PKVENNTP-APGDYHPEKVRQDHVPAFSFAGRHDLHKPN---ETP 1158
                                |..||..| ..|.....:|..|.|..........:..|.   |..
  Fly   931 VAGLNLDEIVHFRNKEIIIYPDDENKPPIGQGLNRDAQVTLDQVWPLDKTKHEAIKDPQRLLEMD 995

  Fly  1159 APGAYSPEKVRQDHNPAFTMAGKHDPKVTHDTPAPGDYHPEKVRLDHNPAFSFAGRHDLHKPSET 1223
            ..|     |:|:       :..|:|.:.....|..|.:   ..|:.|   ||..|..|..:..|.
  Fly   996 WEG-----KLRR-------VCDKNDTRFIEYRPETGSW---VFRVKH---FSKYGLGDSDEEDEL 1042

  Fly  1224 PAPGDYFPEK---------------------VRQDFNPAFTFAGKHDPRSLSESPAPG----DYS 1263
            |..    |:|                     :||....:...|...||::|....|.|    |.:
  Fly  1043 PTD----PKKAKIATLEAQQRANAEKMTLNSLRQAQKISEDAARNLDPKALVAGVASGFRPMDDT 1103

  Fly  1264 PEKVRLDHAPAFSFGGKHD------PKTEHLHPAPC-------------------------DYAP 1297
            .|.:.:|....|..||..|      |:......:|.                         |.||
  Fly  1104 AEFLLMDKTQFFQAGGNSDFSMFDPPRQRPTITSPTAVLAQEMVGNEAHKMQLMKSSFFVEDNAP 1168

  Fly  1298 EKVRLDHT----------------------------------PAYTIAGRPAADHVSQTPAPCDY 1328
            |...::.|                                  ||.     |.:..||:....||.
  Fly  1169 EDEPMETTGRLLRHRKFFNVEPLVWKDGASESSSQYDFEHPSPAL-----PISSSVSEASLMCDA 1228

  Fly  1329 HPEQCQVDSTPAFTFGMRLGRERISDTPAPSAYEPEKHSLHSTPAYSFGTKSDI-----RVTTDA 1388
            |.|:....:|.:..                :|.:..|..:..|.|:.|..|..:     |.|| .
  Fly  1229 HYEETSSMATGSIV----------------AAVKETKFEMPVTKAFKFVCKPKVAPIKLRATT-V 1276

  Fly  1389 PAP---------------GHYHPEQCKLDSSPAYSF----------GLKTVPTASLP-----EPR 1423
            |.|               |.|.....||...|..|.          .||.....|||     .||
  Fly  1277 PLPRSIAYEMRDNWIADLGFYKGRSFKLSFGPQNSLVLPSTYNNMQNLKEFTGPSLPVSMVFAPR 1341

  Fly  1424 GAY--------------------IEDRIVQRRERRLASPVRNNAECTTTTTNHTNNNAGSSTTTT 1468
            .|.                    ..:.|:...|.:|...:..|.|.:.....|.::.        
  Fly  1342 SATDLSPSVMQLVEFNMVKGNEGFRESIIPHLEVQLNDCLSVNVEGSECPCIHPDSG-------- 1398

  Fly  1469 TTTTTTTKTFINGVEQPELQKKETTK--------QVNGTHKEL----KSAPQAPLSNGNIVSN-- 1519
              |...:|.|...::|.....||...        .:.|.|.||    |::....:...|::|.  
  Fly  1399 --TKLVSKHFSESLKQRNAGLKEDYSVSVWSLLFALWGDHDELVDLEKNSHYMVMCRRNLLSEWL 1461

  Fly  1520 -----GNH--SKMVSTTTRIQEV-----AHGQKES---------GNLKVVASGKSDAS 1556
                 |..  ||.|||.:.::.:     .|...|:         .||.:|.|..|..:
  Fly  1462 ENTLLGKDLLSKKVSTHSYLEHMLDLLSCHRVNEACELAFSYDDANLALVLSQLSSGA 1519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Nup98-96NP_001262885.1 Nucleoporin_FG <1..74 CDD:316182 1/1 (100%)
Nucleoporin_FG 50..164 CDD:316182 21/97 (22%)
Nucleoporin_FG 254..318 CDD:316182 6/64 (9%)
NupH_GANP 316..>522 CDD:318883 56/238 (24%)
Nucleoporin_FG 395..481 CDD:316182 24/101 (24%)
Nucleoporin2 888..1027 CDD:309287 28/169 (17%)
Nup96 1484..1762 CDD:314912 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R852
11.030

Return to query results.
Submit another query.