DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Odf3l2

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001028645.1 Gene:Odf3l2 / 382384 MGIID:2686003 Length:277 Species:Mus musculus


Alignment Length:276 Identity:79/276 - (28%)
Similarity:120/276 - (43%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 HIP----AYSFGLKTKHIQVSDTPAPGAYSPEKSRLHSAPAYSIAGKASQDVVDCTPAPGAYEPE 341
            |||    ..|.|:.|    :.:...||.|                         ..|:...|...
Mouse    25 HIPETGLRKSCGIAT----LENGSGPGLY-------------------------VLPSTVGYVNH 60

  Fly   342 KCVLSRTPAFSFGHRAELAKSSD-TPAPGTY-NPEKVRLDHT--PAFTLSGRPETRSVSETPAPG 402
            .|..:.:||:|...|...|...| :|.|..: :|:..|...:  ||:::.||.:.|.:..||.||
Mouse    61 DCTKAASPAYSLARRPSEAPLQDSSPGPVYFLDPKVTRFGRSCPPAYSMQGRAKVRGLEVTPGPG 125

  Fly   403 SYAPEK---YRNDRTPAFTFGGKHEQR-LESSTPAPGDYCPEKVRHDH------NPAFSFAGR-- 455
            :|:|||   .|....||||.|.:..|: .::|.|||..|....:....      :|:::..||  
Mouse   126 AYSPEKAPPVRQRNAPAFTLGSRLRQKPPDTSVPAPNAYTMPPLWGSQIFIKPSSPSYTVVGRTP 190

  Fly   456 --HDLHKPSDTPAPGAY---DTEKVRQDHNPAFSFAGRHDLHKPSE-TPAPGAYSPEK--VRQDH 512
              .....||:.|.||.|   |....|| ..||||..||....:|.| ||.||.::||:  |.:..
Mouse   191 PARPPQDPSEIPGPGQYESPDPNTYRQ-RRPAFSILGRPRTPRPLEDTPGPGTHNPEQVTVNRAR 254

  Fly   513 NPAFSMAGKHSQKVTS 528
            .||::|..:||::.::
Mouse   255 APAYTMGIRHSKRAST 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Odf3l2NP_001028645.1 STPGR 1 122..148 13/25 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..277 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100875
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.