DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC5A11 and slc5a9

Sequence 1:NP_609192.1 Gene:SLC5A11 FlyBaseID:FBgn0031998 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001107077.1 Gene:slc5a9 ZFINID:ZDB-GENE-080513-3 Length:657 Species:Danio rerio

Alignment Length:614 Identity:139/615 (23%)
Similarity:241/615 (39%) Gaps:129/615 (21%)


  Fly     2 EAVAKKGMENYRFGSVDYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRRKHDFG 66
            |..||..:|     :.|.||.:...|...:.||:      |.::....                 
Zfish    16 EVPAKFTLE-----AADIAVVVVYFVFVLAVGIW------SSIRANRG----------------- 52

  Fly    67 SEKMSEYLLGSRNLKVFPVAMSLIASYI-SGVTI----LGTTSEIYNYGTQY---WFIAIAIMLQ 123
              .:..|.|..|::..:|:..||::|.: ||:.|    .|....:...|.::   |.:       
Zfish    53 --TVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNAAWVL------- 108

  Fly   124 GIAVSYVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILF----LPFIVYVPAIALNQ 184
             ||:.::::||:.:..|.:..|||..||..  :.|..:|.:|..||:    :...::..|:.:..
Zfish   109 -IALGWIFVPVYISAGVVTMPEYLRKRFGG--QRIRIYMSVLSLILYILTKISTDIFSGALFIQV 170

  Fly   185 VSGINLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILA---TVYANGLNVLF 246
            ..|.:|::..|:::.|...||..||:.||::|||.|.::|.:....:..:|   ..:..||.|.:
Zfish   171 SLGWDLYLSTVILLAVTALYTIAGGLTAVIYTDALQTVIMVIGAFVLMFIAFDKVGWYEGLLVQY 235

  Fly   247 DDAAKGGRLIFNNTN------------PSPYVRHTVWSVLIGGFS-----YWTSFNAVNQTMVQR 294
            :.||..  |...||.            ..|......|..||.|.:     .|    ..:|.:|||
Zfish   236 EKAAPA--LTVPNTTCHLPRSDAFHIFRDPVTGDIPWPGLIFGLTVLATWVW----CTDQVIVQR 294

  Fly   295 YMSLPSLKKARASMAI---------FTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQL 350
            .:|..:|..|:|...:         |.:.:...:|...|...:......:|..:....:...:..
Zfish   295 SLSAKNLSHAKAGSVLGGYLKVFPMFFVVMPGMISRALYPDEVACVDPDECQKICGAKVGCSNIA 359

  Fly   351 LPLFVVQSVGHIYGMSGLFIAGIFGAALSSLSVVLNSTSLVILEDIVRGCFKMQPSERASTILVK 415
            .|..||:.:.  .||.||.||.:..|.:|||:.:.||:|.:...||.:   :::|......::|.
Zfish   360 YPKLVVELMP--VGMRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWQ---RIRPRASEKELMVV 419

  Fly   416 STVIVLGFVALSLVFV-------LEQLSGILSICTSMTAIAAGTTFGLFTLGMLVPW--ANTVGT 471
            ..|.:|..||||:|::       ..||...:...||..:....|.|     .|.:.|  .|..| 
Zfish   420 GRVFILLLVALSIVWIPVIQTANSGQLFDYIQAITSFLSPPITTVF-----IMAIFWGRVNEQG- 478

  Fly   472 AVGGIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGCVGNVTLRENIWVDEEQVFPLYRLSYH 536
            |..|:...|:.|.:....:|.            .....| |...||.::..|         :.|.
Zfish   479 AFWGLMVGLVVGMVRMIMEFV------------YGTPSC-GETDLRPSLLKD---------VHYL 521

  Fly   537 WINPIGVATVIVVGALVSLVTKPTNMKTL 565
            :...|.:|..:::...|||.|.|...|.|
Zfish   522 YFALILLALTVLIITAVSLCTAPIPEKHL 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC5A11NP_609192.1 SLC5sbd_NIS-SMVT 17..556 CDD:271383 131/589 (22%)
slc5a9NP_001107077.1 SLC5sbd_SGLT4 42..657 CDD:271380 131/584 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110685857
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.