DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC5A11 and SPAC869.03c

Sequence 1:NP_609192.1 Gene:SLC5A11 FlyBaseID:FBgn0031998 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_595016.1 Gene:SPAC869.03c PomBaseID:SPAC869.03c Length:661 Species:Schizosaccharomyces pombe

Alignment Length:572 Identity:121/573 (21%)
Similarity:233/573 (41%) Gaps:133/573 (23%)


  Fly     2 EAVAKKGMENYRFGSV---DYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRRKH 63
            |.|..:|   |.:|.|   .:|..:.||:::.....|.|.::.|:                    
pombe     3 ETVLNQG---YGYGIVIGLGFAFAIVMILVTYVLKRYVGEVQDSE-------------------- 44

  Fly    64 DFGSEKMSEYLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGT--QYWFIAIAIMLQGIA 126
                    .:...||::|...::.::::|:....|:|.:....|.||.  ..|: :.|..:|   
pombe    45 --------HFTTASRSVKTGLISSAVVSSWTWPGTLLTSAGMAYEYGVCGSMWY-SFAFTVQ--- 97

  Fly   127 VSYVYIPVFS--ALQV-------GSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIAL 182
                 |..|:  ||||       .:..|.::.||.....::..|..:...|:....::...:.|:
pombe    98 -----ITFFTVIALQVKRVAPGAHTIVEIVKARFGQASHAVFLFYALGTNIIVSAMLLLGGSQAI 157

  Fly   183 NQVSGINLHVIAV--VIVVVCVFYTFVGGIKAVVHTDAWQ----VLVMFLSVLAVAILATVYANG 241
            :.::|  :||:|.  ::.:....||..||:|:...:| |.    |.::.|..|.||..::|:...
pombe   158 SAITG--MHVVAAGFLLPLGVWLYTVSGGLKSTFLSD-WTHTVIVYIVILITLFVAYTSSVHIGS 219

  Fly   242 LNVLFDDAAKGGRLIFNNTNPS-----PYV----RHTV---WSVLIGGFSYWTSFNAVNQTMVQR 294
            ::.::|...:     .:.||||     .|:    |..|   |:::||||:  |.|  .:.:..|:
pombe   220 IDKMYDLLTE-----VSKTNPSTGYKGSYLTVTNRDAVFVGWNIVIGGFA--TVF--CDPSYGQK 275

  Fly   295 YMSLPSLKKARASMA--------IFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLL 351
            .::...:...:...|        .:.:|.||.:|......          :|:|   :|:.|.:.
pombe   276 AIAAKPISAMKGYFAGGLAWLIVPWAMGSAAALSCLALTN----------NPVS---VTYPDPVS 327

  Fly   352 PLFVVQSVGHIYGMSGLF-----IAGI---FGAALSSLSVVLNSTSLVILEDIVRGCFKMQPS-- 406
            ...|.:.:..:|||:.|.     .||:   |.|:.|:.|..|.:.|.|:..|:.|..|:...|  
pombe   328 SKQVSEGMPLLYGMTALMGKNGAAAGVLILFMASTSATSAELVAFSSVMTYDVYRNYFRPNASGK 392

  Fly   407 --ERASTILVKSTVIVLGFVALSLVFVLEQLSGILS-ICTSMTAIAAGTTFGLF-----TLGMLV 463
              .|.:.:.|....:.:|.:|:...::...:|.|:: |..::.....|.|..||     ..||: 
pombe   393 ELVRVTHVFVTIFAVCMGALAVLFNYIGITISWIITFIGIALGPAVFGITLTLFWKKMNKYGMI- 456

  Fly   464 PWANTVGTAVGGIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGCVGNVT 515
                 :|..:|.|...:.  |:  |:.:..:.|.:|...|.......|||.|
pombe   457 -----IGCPMGSITGVVC--WV--GSCYKFSNGVVNKTTLNTPYANAVGNFT 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC5A11NP_609192.1 SLC5sbd_NIS-SMVT 17..556 CDD:271383 116/558 (21%)
SPAC869.03cNP_595016.1 SLC5sbd_DUR3 12..515 CDD:271370 117/561 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1826
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.