DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC5A11 and F52H2.4

Sequence 1:NP_609192.1 Gene:SLC5A11 FlyBaseID:FBgn0031998 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_508460.3 Gene:F52H2.4 WormBaseID:WBGene00018716 Length:486 Species:Caenorhabditis elegans

Alignment Length:504 Identity:147/505 (29%)
Similarity:248/505 (49%) Gaps:51/505 (10%)


  Fly   114 WFIAIAIMLQGIAVSYVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVP 178
            ||..:.::...| |::|::||...|::.:.|||.|.||....|.:.:.:|.:..||:....:|.|
 Worm     4 WFAPMYVISFPI-VAFVFLPVLYRLKLTTIYEYFERRFDYKCRFVTTSLFCVQMILYNSVALYAP 67

  Fly   179 AIALNQVSGINLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLN 243
            ::|:..::.|.:.|..::..|:..||..|||:||.:||.|.|:|::||::..: |..::....::
 Worm    68 SLAIASITNIPITVSILITAVLSAFYISVGGVKAGIHTSAIQMLLIFLTMTFI-ISISLREMSIH 131

  Fly   244 VLFDDAAKGGRLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKAR--- 305
            .::.....|.|...|     |.:||:|||:||||.....:..|.||..:||||::.:||.|:   
 Worm   132 DVYTSVVHGKRFRIN-----PTIRHSVWSLLIGGTGNILALFAANQLSIQRYMAMDTLKSAQKVV 191

  Fly   306 -ASMAIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGHIYGMSGLF 369
             .::...||.:.::||    ||.|||..||||.|    .|.:.::|||.||:.......|..|||
 Worm   192 LLNIVCNTIILVSYVS----VGFLIYAHYKDCHP----QIGNANELLPRFVMDVTSKYPGSVGLF 248

  Fly   370 IAGIFGAALSSLSVVLNSTSLVILED---IVRGCFKMQP-----SERASTILVKSTVIVLGFVAL 426
            .|.::.|.:|:||....:.|.:::.|   :.|...||.|     .:.|..||    .|||.|:::
 Worm   249 AAAVYSAGISTLSASFTAVSSIVINDVWKVYRERRKMAPLRNDQVQNAMRIL----PIVLSFISI 309

  Fly   427 SLVFVLEQL-SGILSICTSMTAIAAGTTFGLFTLGMLVPWANTVGTAVGGIASALLAGWISFGT- 489
            .:.|:...| |.||.:...:.....|...|.|.:|:.||........||.|.|.::...||.|: 
 Worm   310 FVAFLCSMLQSIILQVSFIVFGAGGGPVLGSFVVGLFVPRVKEKAALVGLIGSIIVCFSISIGSV 374

  Fly   490 -----QFTIAAGELNSQKLPVSVEGCVGNVTLRENIWVDEEQVFPLYRLSYHWINPIGVAT---- 545
                 ...:..|:.::|.|....|..:|.||....::..|.    ::.:||.:.:.|.|.|    
 Worm   375 LVKVKPVALELGQCSNQTLTYFDESFIGAVTSTPLVFGLER----IFAISYQYYSIIAVVTNVAL 435

  Fly   546 VIVVGALVSLVTKPTNMKTLDPDLISPVIHRFLPKECFSGRNLHAQAHK 594
            .||:..|..|.:...|...:..:|:||::     ....|.|:...:||:
 Worm   436 SIVMQKLFELCSLTANHLPVSHELVSPLL-----TYSSSKRDPELEAHR 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC5A11NP_609192.1 SLC5sbd_NIS-SMVT 17..556 CDD:271383 139/465 (30%)
F52H2.4NP_508460.3 SLC5-6-like_sbd 1..442 CDD:294310 137/461 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 1 1.000 T374960
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.