DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC5A11 and LOC103694884

Sequence 1:NP_609192.1 Gene:SLC5A11 FlyBaseID:FBgn0031998 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_008772077.2 Gene:LOC103694884 RGDID:9241114 Length:646 Species:Rattus norvegicus

Alignment Length:575 Identity:112/576 (19%)
Similarity:215/576 (37%) Gaps:143/576 (25%)


  Fly    81 KVFPVAMSLIAS-----YISGVTILGTTSEIYNYGTQYWFIAIAIMLQGIAVSYVYIPVFSALQV 140
            |.:.:.:|:.:|     :..|:..:|..|.| ..|...|.....:.:.|    ::::|::|...|
  Rat    15 KCWEMGLSIYSSTVGSGHFMGLAGIGAASGI-AVGAFEWNTVFMLFMLG----WIFVPIYSKAGV 74

  Fly   141 GSSYEYLEMRFHSV-VRSIASFMFILDEILF-LPFIVYVPAIALNQVSGINLHVIAVVIVVVCVF 203
            .:..|||:.||.|| ::...||:|::..||. :...:...|:.|..|..|:::...:.::.:...
  Rat    75 VTLPEYLKKRFGSVRIQLFFSFVFLIVYILSRISMEIGFGAMFLKMVWDIDIYQTMLTVLTITGV 139

  Fly   204 YTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNVLFDDAAKGGRLIFNNTN----PSP 264
            ||..||:..|.:.:..|..:|.|....:...|.....|...|.:..:|.........|    |..
  Rat   140 YTITGGLATVAYVETLQAGIMVLGSALLMGYAFYEVGGYQELVNKYSKAIPSTIQQGNWTAKPEC 204

  Fly   265 YV---------RHTV-----W-SVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKARASM------ 308
            |.         |..|     | .:::|..:....:...:|..|||:::    .|:|..|      
  Rat   205 YTPREDAFHVFRSCVSGDVPWPGLVLGATTVSLFYGCADQVSVQRFLA----GKSRLHMEGGCLL 265

  Fly   309 -------AIFTIGVAAFVS-------VCCYVGLLIYEMYKDCDPL---SAGLITHDDQLLPLFVV 356
                   .:|.:.:...:|       |.|.|.       .:|:..   ..|.......:|.|.|:
  Rat   266 CGYLKLLPMFLMVMPGMISRVLFPDQVACVVP-------SECEKFCGRGTGCSALAYPVLVLGVM 323

  Fly   357 QSVGHIYGMSGLFIAGIFGAALSSLSVVLNSTSLVILEDIVRGCFKMQPSERASTILVKSTVIVL 421
            .|     |:.|..::.:..:.:|||:.:.||:|.:...:|...   ::|:.....:::.....|:
  Rat   324 PS-----GLQGFMLSTVCASLMSSLTSIFNSSSALFTLNIYTW---IRPTATEKELMIAGRFFVI 380

  Fly   422 GFVALSLVFV----------LEQLSGILSIC--TSMTAIAAGTTF-------GLFTLGMLVPWAN 467
            ..:|:::|::          |.:...||..|  .|:||:.....|       |.|       |..
  Rat   381 ILLAVTIVWIPIIEMAPSETLFEYMQILKSCLTPSVTAVFLLAVFCKRVNEQGAF-------WGL 438

  Fly   468 TVGTAVGGIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGCVGNVTLRENIWVDEEQVFPLYR 532
            .:|:.:|  ...|||.:. :|..   ..||  .::.|:.:.|                       
  Rat   439 ILGSTIG--VFRLLAEFF-YGPP---TCGE--DRQCPIFICG----------------------- 472

  Fly   533 LSYHWINPIGVATVIVVGALVSLVTKPTNMKTLDPDLISPVIHRFLPKECFSGRN 587
            |.|.:.....:...|::...:||.|:|         :....:|..    |:|.||
  Rat   473 LHYLYFGFCLLLVSILIILAISLATEP---------IADDHLHGL----CWSLRN 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC5A11NP_609192.1 SLC5sbd_NIS-SMVT 17..556 CDD:271383 105/543 (19%)
LOC103694884XP_008772077.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110466350
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.