DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and TED1

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_012225.1 Gene:TED1 SGDID:S000001301 Length:473 Species:Saccharomyces cerevisiae

Alignment Length:470 Identity:84/471 (18%)
Similarity:138/471 (29%) Gaps:189/471 (40%)


  Fly    13 CALIFCEYVADFVVL--------------QKCKW-------PEIKRKKYV--------------- 41
            ||:....|.|.|:.:              ::|.|       |..|...:|               
Yeast     4 CAVKKFAYFATFLTIVANIYIYTYPSFHPEQCSWNCSNKNAPLQKDLTFVDKVKNYFSDVREQWH 68

  Fly    42 --------DDPLRAMILADPHLLGPHRGHW--------LDKLYREWHMTRAFQAASRLFQPDVVF 90
                    |:.:..:...||.:    :|.|        ||....::::...:....:..:|.||.
Yeast    69 GSHASAGNDEDIHILAFGDPQI----KGIWPKTPYVSRLDTYGNDYYLGHIYDMMQQRLKPQVVT 129

  Fly    91 VLGDLFDEGDMVSDKQFQEYVWRYL-KMFHLPP-------------------------------- 122
            |:|||| ....:.|.:|.....||: ::|...|                                
Yeast   130 VMGDLF-SSQWIGDSEFHNRTKRYISRIFKRDPTSIENIKQQNLDEKGQYKANWPEWGDRFNEIL 193

  Fly   123 ------------------------------GIPLISVAGNHDVGFHYKMHPFFMSRFESYLNNSS 157
                                          ...:|::.||||||:........|:||.......:
Yeast   194 DNVKENEADNQELSFGFGYENIHSWNPDLEDFLIINITGNHDVGYSGDATYQHMTRFHDLFGKDN 258

  Fly   158 VNL-YTIKQIH---FVVINSMAMEGDGC---------MFCTQAEDQLKNISRTLYCMKYPLEAEC 209
            ..: |.....|   .||:|.:.:||...         :|..|..::..|                
Yeast   259 YWIEYETNTTHPWRIVVLNDLLLEGPALQPEFVEATWIFLNQLNERKFN---------------- 307

  Fly   210 ARTRRHPYSQPILLQHFPTYRISDTMCEEHDAPYI------EAF-----RERFHV---LSKDATD 260
                    ...:||.|.|.|:......:..|..|.      |::     |.:.|:   :|....:
Yeast   308 --------GSTVLLTHVPFYKREGLCVDGPDTRYYPDAHAPESYKSGLLRSQNHLSESVSNQVLN 364

  Fly   261 MLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVASFSWRNKVNPSFMLAT--ITPDDYVVS-KCK 322
            |:.|..||.:...||.|..|.:|               .||.:.|...||  |..|.:|.. ..|
Yeast   365 MIFENGKPGIILTGHDHEGCETV---------------YNKKSTSTWEATKNIESDVFVKEITVK 414

  Fly   323 MLPQQFVFNSYLSAG 337
            .:..:|..|:.|..|
Yeast   415 SMMGEFNGNTGLVTG 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 58/332 (17%)
MPP_MPPE1 48..301 CDD:277372 61/351 (17%)
TED1NP_012225.1 MPP_Ted1 83..421 CDD:277371 70/382 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197070085
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.