DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP5 and CDC1

DIOPT Version :9

Sequence 1:NP_609191.1 Gene:PGAP5 / 34116 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_010468.1 Gene:CDC1 / 851763 SGDID:S000002590 Length:491 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:80/345 - (23%)
Similarity:149/345 - (43%) Gaps:57/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFLYACFVIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLG-------PH 59
            |::...:::.|..:.:.|.|.....::||:|...:......:..|..:.|||.::.       |.
Yeast    45 RYISIVWILWLGLISYYESVVVKRAMKKCQWSTWEDWPEGAESHRVGLFADPQIMDEYSYPGRPQ 109

  Fly    60 RGHWLDKLYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGI 124
            ..::..::..:.:..|.::.......||..|.||||||.|....|||:.:...|:.::|   |..
Yeast   110 IVNYFTRVIVDHYHRRNWKYVQYYLDPDSNFFLGDLFDGGRNWDDKQWIKEYTRFNQIF---PKK 171

  Fly   125 PL----ISVAGNHDVGFHYKMHPFFMSRFESYLNNSSVNL----YTIKQIHFVVINSMAMEGDGC 181
            ||    :|:.||||:||...:....:.||.||...:|.:|    :|     ||:::::::     
Yeast   172 PLRRTVMSLPGNHDIGFGDTVVESSLQRFSSYFGETSSSLDAGNHT-----FVLLDTISL----- 226

  Fly   182 MFCTQAEDQLKNISRT--LYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTM-C---EEHD 240
                 ::....|:||.  .:...:.:.:       ||..: |||.|.|.:|..:.. |   .|..
Yeast   227 -----SDKTNPNVSRVPRQFLDNFAMGS-------HPLPR-ILLTHVPLWRDPEQQTCGQLRESK 278

  Fly   241 APY-IEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHHFC---HSVNRLG----IDEYTVASFS 297
            .|: |:...:...|:..|.:..:...::|.:.|:|..|..|   ||....|    ..|.||.|.:
Yeast   279 EPFPIQKGHQYQTVIENDISQEILTKIQPEILFSGDDHDHCQISHSYPFQGKTKNAQEITVKSCA 343

  Fly   298 WRNKVN-PSFMLATI-TPDD 315
            ....:: |:..|.:: .|.|
Yeast   344 MNMGISRPAIQLLSLYNPSD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 61/255 (24%)
MPP_MPPE1 48..301 CDD:277372 68/281 (24%)
CDC1NP_010468.1 MPP_Cdc1 91..347 CDD:277370 68/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I2732
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1739
Isobase 1 0.950 - 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003247
OrthoInspector 1 1.000 - - oto100259
orthoMCL 1 0.900 - - OOG6_104282
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1923
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.