| Sequence 1: | NP_609191.1 | Gene: | PGAP5 / 34116 | FlyBaseID: | FBgn0031997 | Length: | 370 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_010468.1 | Gene: | CDC1 / 851763 | SGDID: | S000002590 | Length: | 491 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 345 | Identity: | 80/345 - (23%) |
|---|---|---|---|
| Similarity: | 149/345 - (43%) | Gaps: | 57/345 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 RFLYACFVIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLG-------PH 59
Fly 60 RGHWLDKLYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGI 124
Fly 125 PL----ISVAGNHDVGFHYKMHPFFMSRFESYLNNSSVNL----YTIKQIHFVVINSMAMEGDGC 181
Fly 182 MFCTQAEDQLKNISRT--LYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTM-C---EEHD 240
Fly 241 APY-IEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHHFC---HSVNRLG----IDEYTVASFS 297
Fly 298 WRNKVN-PSFMLATI-TPDD 315 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PGAP5 | NP_609191.1 | Metallophos | 45..279 | CDD:278574 | 61/255 (24%) |
| MPP_MPPE1 | 48..301 | CDD:277372 | 68/281 (24%) | ||
| CDC1 | NP_010468.1 | MPP_Cdc1 | 91..347 | CDD:277370 | 68/281 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I2732 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3662 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 65 | 1.000 | Inparanoid score | I1739 |
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3042 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0003247 | |
| OrthoInspector | 1 | 1.000 | - | - | oto100259 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_104282 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1923 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 9.740 | |||||