DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and Mppe

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster

Alignment Length:399 Identity:78/400 (20%)
Similarity:147/400 (37%) Gaps:124/400 (31%)


  Fly     8 FVIVLCALIFCEYVADFVV--LQKCKWPEIKRKKYVDDPLRAMILADPHLLG---PHRGHW-LDK 66
            ||.:...|:|..   :|:|  :.:..|..|..|  :|:..|.:::|||.:||   ....|. |.:
  Fly    17 FVALTLLLVFFN---EFIVYYMAQSSWQPIDCK--LDNCTRLLLIADPQILGNSYDRSSHSPLAR 76

  Fly    67 LYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFH---------LPP 122
            ...:.::.:.|:.|....||.::..||||.|||::.:.:::::||.|:.:::.         :..
  Fly    77 YDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFRMISA 141

  Fly   123 GIPLISVAGNHDVGFHYKMHPFFMSRFESYLNNS----------SVNLYTI-KQIHFVVINSMAM 176
            ....:.|.|::|:|          .....|::||          |.:|:.. .::.|..||.|.:
  Fly   142 FFQRVHVPGDNDIG----------GENGDYISNSNQRRFENEFMSEDLFDYDNRLRFFKINRMLL 196

  Fly   177 EGDGCMFCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYR--ISDTMCEEH 239
            :             ..|..|         :....|.|......|:|:...|..|  |||      
  Fly   197 D-------------FSNPDR---------DNNADRLRIGVSHAPLLIGGGPLLRAIISD------ 233

  Fly   240 DAPYIEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHH---FCH-SVNRLGIDEYTVASFSWR- 299
                                      |.|.:.|:||.|.   |.: |...:...|.:|..|..: 
  Fly   234 --------------------------LDPHIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLKA 272

  Fly   300 -NKVNPSFMLATITPDDYVVSKCKM------------------LPQQFV-FNSYLSAG--ILCLI 342
             .:...|::...:....|.:.|.|:                  .|.:|: ..:|:..|  ::|..
  Fly   273 LKEQEHSYLEIMVPTCSYRMGKSKIGLGYAVLENYNLSYTVLWQPNRFILLFTYVFWGLFVVCGF 337

  Fly   343 VIGFQLRKC 351
            |:...:.:|
  Fly   338 VVFKMMTRC 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 52/263 (20%)
MPP_MPPE1 48..301 CDD:277372 56/285 (20%)
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 52/258 (20%)
MPP_Cdc1_like_1 54..293 CDD:277373 58/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197073493
eggNOG 1 0.900 E1_KOG3662
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3042
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13315
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
54.910

Return to query results.
Submit another query.