DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and Mppe1

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_011245209.1 Gene:Mppe1 MGIID:2661311 Length:420 Species:Mus musculus

Alignment Length:372 Identity:158/373 (42%)
Similarity:223/373 (60%) Gaps:39/373 (10%)


  Fly     9 VIVLCALIFCEYVADFVVLQKCKWPEIK------RKKYVDDPLRAMILADPHLLGPHRGHWLDKL 67
            |:::..|:||||...::||.:|.|||:|      |::.|   |:||.|||.||||..||||||||
Mouse    29 VVIISVLLFCEYFIYYLVLFRCHWPEVKTLAHGGRQEPV---LKAMFLADTHLLGEIRGHWLDKL 90

  Fly    68 YREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGIPLISVAGN 132
            .|||.|.||||.|..|.||:|||:|||:||||...||:.:.:.|.|:.:||.....:.|..|.||
Mouse    91 RREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSSDQAWADDVQRFQRMFRHDSHVQLKVVIGN 155

  Fly   133 HDVGFHYKMHPFFMSRFESYLNNSS-VNLYTIKQ-------------------IH-FVVINSMAM 176
            |||||||:|..:.:.|||....:.. ::|..:||                   :| ||::||:||
Mouse   156 HDVGFHYQMSKYRIKRFEKVFGSERLLSLKGVKQDLSMLPLQRQTPELGLYPHLHSFVMVNSVAM 220

  Fly   177 EGDGCMFCTQAEDQLKNISRTLYCM--KYPLEAECAR--TRRHPYSQPILLQHFPTYRISDTMCE 237
            |||||:.|::.|.:|:.|||.|.|.  :.|..::|.|  ..|.|.|.|:||||:|.||.||..|.
Mouse   221 EGDGCIICSEEEAELREISRKLNCSQEQVPGSSQCDREPEPRLPLSAPVLLQHYPLYRASDANCS 285

  Fly   238 EHDAPYIE----AFRERFHVLSKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVASFSW 298
            ..||...|    .|.|::.|||::|:..|...|:|||..:||:|..|..::..|..|.:|.||||
Mouse   286 GEDAAPPEERNVPFEEKYDVLSREASQKLLWWLRPRLVLSGHTHSACEVLHPGGAPEVSVPSFSW 350

  Fly   299 RNKVNPSFMLATITPDDYVVSKCKMLPQQFVFNSY-LSAGILCLIVI 344
            ||:.||||::.::|..||.:|||.:..:..|...| .:||.|.::::
Mouse   351 RNRNNPSFIMGSLTSRDYALSKCYLPFEDTVLTMYGAAAGFLMILIL 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 118/263 (45%)
MPP_MPPE1 48..301 CDD:277372 126/282 (45%)
Mppe1XP_011245209.1 Metallophos 68..>188 CDD:278574 62/120 (52%)
MPP_MPPE1 71..353 CDD:277372 126/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197052478
eggNOG 1 0.900 E1_KOG3662
Hieranoid 1 1.000
Homologene 1 1.000 H41512
Inparanoid 1 1.050 295 1.000 Inparanoid score I2716
Isobase 1 0.950 0 Normalized mean entropy S3042
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004255
OrthoInspector 1 1.000 T1084511
orthoMCL 1 0.900 OOG5_129925
Panther 1 1.100 LDO PTHR13315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.