DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and ZK792.7

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_502214.2 Gene:ZK792.7 WormBaseID:WBGene00014079 Length:342 Species:Caenorhabditis elegans

Alignment Length:407 Identity:88/408 (22%)
Similarity:151/408 (37%) Gaps:128/408 (31%)


  Fly     3 FLYACFVIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLGPHRGHWLDKL 67
            |:|....:||..:|.......:..|.: :|||.:.....|   |.:|:|||.|:| ::.....::
 Worm    10 FIYGIPALVLAFVILWNESWSYWWLSR-QWPEHEENGRCD---RILIVADPQLIG-YKNEKFGEI 69

  Fly    68 YREW----HMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGIPLIS 128
            .| |    ::...:..|...|.|..|..||||||||...:|.::.|...|::.::.:..|...|.
 Worm    70 SR-WDSDRYLATGYSYAKWRFLPTTVMFLGDLFDEGIESNDDEWYETYERFIGIYPIDRGDNAIY 133

  Fly   129 VAGNHDVGFHYKMHPFFMSRFESYLNNSSVNLYTIKQIHFVVINSMAMEGDGCMFCTQAEDQLKN 193
            :||::|:|...::  ...||...:.|....|:..:|..:                         :
 Worm   134 IAGDNDIGGESEL--ISESRRNQFYNYFRNNVSDLKDRY-------------------------S 171

  Fly   194 ISRTLYCMKYPLEAECARTRRHPYSQPILLQHFP----TYRISDTMCEEHDAPYIEAFRERFHVL 254
            ||.| |..:.|:.....:. :.|.:: |:|.|.|    .|:.||                     
 Worm   172 ISET-YLFENPILKHITKA-QVPVAK-IMLTHVPYLVEGYKHSD--------------------- 212

  Fly   255 SKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVAS-----FSWRNKVNPSF-------- 306
                   :|:  |..|..:.|.|       ..||.||..::     |:..:.|:|::        
 Worm   213 -------VGQ--KMDLILSAHDH-------TTGIYEYQRSAPRAVLFTRVSDVSPTYFKNIGQNE 261

  Fly   307 -MLATITP----------------------DDY----VVSKCKMLPQQFVFNSYLSAGILCLIVI 344
             ::...||                      |||    |......||.:|   :.|...|..||..
 Worm   262 PLIELQTPTCSYRMGVYSMGYGALSICRLNDDYRSVQVQYSVLWLPSRF---AQLFLYIFSLIFS 323

  Fly   345 GFQL---RKCIQSRRQS 358
            .|.:   ::| ::||.|
 Worm   324 AFWIIFQKRC-RTRRYS 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 53/242 (22%)
MPP_MPPE1 48..301 CDD:277372 57/266 (21%)
ZK792.7NP_502214.2 MPP_Cdc1_like_1 51..276 CDD:277373 61/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.