DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and mppe-1

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001251443.1 Gene:mppe-1 WormBaseID:WBGene00015238 Length:365 Species:Caenorhabditis elegans

Alignment Length:363 Identity:131/364 (36%)
Similarity:195/364 (54%) Gaps:35/364 (10%)


  Fly     9 VIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLGPHRGHWLDKLYREWHM 73
            ::.:..:::.||...|:....|:|| .|..:..:..::|.:::|.||||...|||||||.|||.|
 Worm    12 LLAIILVVYNEYFIFFIAFSSCQWP-CKYGRCSESSVKAFMISDTHLLGKINGHWLDKLKREWQM 75

  Fly    74 TRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGIPLISVAGNHDVGFH 138
            .::|..::.:..|||.|.||||.|||.......|:.|..|:.|:|  .....:|::|||||:|||
 Worm    76 YQSFWISTWIHSPDVTFFLGDLMDEGKWAGRPVFEAYAERFKKLF--GDNEKVITLAGNHDLGFH 138

  Fly   139 YKMHPFFMSRFESYLNNSSVNLYTIKQIHFVVINSMAMEGDGCMFCTQAEDQLKNISRTLYCMKY 203
            |.:.|..:..|:.......::...||:..||:||||||.||||..|.:||..|:.|.        
 Worm   139 YAIMPETLEMFKKEFRRGLIDEMKIKKHRFVLINSMAMHGDGCRLCHEAELILEKIK-------- 195

  Fly   204 PLEAECARTRRHPYSQPILLQHFPTYRISDTMC----EEHDAPYIEAFRERFHVLSKDATDMLGE 264
                     .|:|.::||:|||||.||.||..|    |:|:....|.:||::..|||:::..:.:
 Worm   196 ---------SRNPKNRPIVLQHFPLYRKSDAECDQVDEQHEIDLKEMYREQWDTLSKESSLQIID 251

  Fly   265 LLKPRLAFAGHSHHFCHSV-NRLG----IDEYTVASFSWRNKVNPSFMLATITPDDYVVSKCKML 324
            .|.|:..|.||:|..|... |:.|    ..||||.||||||...|:.:|..|..|:.:||.|::.
 Worm   252 SLNPKAVFGGHTHKMCKKKWNKTGNSEYFYEYTVNSFSWRNGDVPAMLLVVIDGDNVLVSSCRLP 316

  Fly   325 PQQFVFNSYLSAG----ILCLIVIGFQLRKCIQSRRQS 358
            .:......|:..|    ||..|:|..::|  |..||.|
 Worm   317 SEILQIMVYIFGGIGIVILAFILISRRVR--IFKRRPS 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 93/238 (39%)
MPP_MPPE1 48..301 CDD:277372 105/262 (40%)
mppe-1NP_001251443.1 MPP_superfamily 51..292 CDD:301300 104/260 (40%)
Metallophos 52..266 CDD:278574 92/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197062584
eggNOG 1 0.900 E1_KOG3662
Hieranoid 1 1.000
Homologene 1 1.000 H41512
Inparanoid 1 1.050 223 1.000 Inparanoid score I2231
Isobase 1 0.950 0 Normalized mean entropy S3042
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004255
OrthoInspector 1 1.000 T474023
orthoMCL 1 0.900 OOG5_129925
Panther 1 1.100 LDO PTHR13315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.