DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP5 and mppe1

Sequence 1:NP_609191.1 Gene:PGAP5 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002936127.1 Gene:mppe1 XenbaseID:XB-GENE-987928 Length:399 Species:Xenopus tropicalis

Alignment Length:374 Identity:161/375 (43%)
Similarity:225/375 (60%) Gaps:14/375 (4%)


  Fly     3 FLYACFVIVLCALIFCEYVADFVVLQKCKWPEIK--RKKYVDDPLRAMILADPHLLGPHRGHWLD 65
            ||.:.|..:|....|||::..::|:.||.|||:|  .|:.....|:||.|||.||||..||||.|
 Frog    27 FLCSIFGSILLVFFFCEFLVYYLVIVKCSWPEVKGAHKEDSTPVLKAMFLADTHLLGEIRGHWFD 91

  Fly    66 KLYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGIPLISVA 130
            ||.|||.|.|::|:|..|.||||||:|||:||||.....:.:...|.|:.|||..||...||.:.
 Frog    92 KLRREWQMERSYQSALWLLQPDVVFILGDIFDEGKWSIPEAWSRDVVRFQKMFRHPPHTELIVLV 156

  Fly   131 GNHDVGFHYKMHPFFMSRFESYLNNSSVNLYTIKQIHFVVINSMAMEGDGCMFCTQAEDQLKNIS 195
            ||||:||||.|:.:.:||||...|.:|..|.::|.|:||::||:|:|||.|..|..||:||:.||
 Frog   157 GNHDIGFHYDMNIYKLSRFEKTFNFTSGKLVSLKGINFVLLNSVALEGDDCDICRAAENQLERIS 221

  Fly   196 RTLYCMK---YP-LEAECARTRRHPYSQPILLQHFPTYRISDTMCEEHDAPYIE----AFRERFH 252
            ..|.|.:   :| ...:|....:.|.|.||||||:|.||.||..|...|:...|    .|||::.
 Frog   222 TKLSCSRMREHPDFRKKCKNVEKTPMSAPILLQHYPLYRFSDLECTGEDSASPEEKKVLFREKYD 286

  Fly   253 VLSKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVASFSWRNKVNPSFMLATITPDDYV 317
            |||:||:..|.:||:|||..:||:|..|..:::..|.|.:|.||||||:.||||::.:||..:|.
 Frog   287 VLSQDASKKLLQLLQPRLILSGHTHSACEVLHQGKIPEISVPSFSWRNRNNPSFIMGSITAANYS 351

  Fly   318 VSKCKMLPQQFVFNSYLSAGILCLIVIGFQLRKCIQSRRQSSAVDHRKV 366
            ::||.:..:..:...|.:.|.|....:...|..|...|..|.    ||:
 Frog   352 LAKCFLPKENMIIYIYCTVGTLFTSYVLACLWACTIQRIHSG----RKI 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 118/242 (49%)
MPP_MPPE1 48..301 CDD:277372 126/261 (48%)
mppe1XP_002936127.1 Metallophos 71..311 CDD:278574 117/240 (49%)
MPP_MPPE1 74..335 CDD:277372 126/261 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C197054158
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41512
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004255
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.