DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and ACB1

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_011551.3 Gene:ACB1 SGDID:S000003269 Length:87 Species:Saccharomyces cerevisiae

Alignment Length:80 Identity:42/81 (52%)
Similarity:52/81 (64%) Gaps:0/81 (0%)


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            |.|.:.|:.|..|.|.|..::|||||:|||||||||.:.:|||..:.|.:.|||||.|.||.|..
Yeast     4 QLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQE 68

  Fly    70 DAQAAYITKVKALIA 84
            ||:..||..|..|||
Yeast    69 DAEKEYIALVDQLIA 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 42/81 (52%)
ACB1NP_011551.3 ACB 1..87 CDD:226731 42/81 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T634576
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 LDO PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.