DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and ACBP6

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_174462.1 Gene:ACBP6 AraportID:AT1G31812 Length:92 Species:Arabidopsis thaliana

Alignment Length:86 Identity:38/87 (44%)
Similarity:50/87 (57%) Gaps:0/87 (0%)


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            :||.:.||.|..|...|.:.|||.||.|||||..|..:|.:||....|.:|||:||...:|.|:.
plant     5 EEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSE 69

  Fly    70 DAQAAYITKVKALIAAVGLKS 90
            :|...||||||.|:.....|:
plant    70 EAMNDYITKVKQLLEVAASKA 90

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 37/82 (45%)
ACBP6NP_174462.1 ACBP 3..87 CDD:238248 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I2268
OMA 1 1.010
OrthoDB 1 1.010 D1588000at2759
OrthoInspector 1 1.000 T125274
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.