DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and ACBP3

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana

Alignment Length:76 Identity:24/77 (31%)
Similarity:35/77 (45%) Gaps:7/77 (9%)


  Fly     4 LQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSN 68
            |.|.:..||::       |....:||:.|:|.||.|.|...:|..:....:|||.||.....||.
plant   241 LLEESGKAEEI-------GAEAKMELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQ 298

  Fly    69 TDAQAAYITKV 79
            .:|...|:..|
plant   299 EEAMEQYLALV 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 23/76 (30%)
ACBP3NP_001119041.1 ACBP 232..314 CDD:279259 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.