DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbd7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_084339.1 Gene:Acbd7 MGIID:1925495 Length:88 Species:Mus musculus

Alignment Length:88 Identity:47/89 (53%)
Similarity:60/89 (67%) Gaps:0/89 (0%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||...:|:|||:||:.|.:.|.|.:|.|||.||||:.:||.|...|..||.||||||||||.:||
Mouse     1 MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKG 65

  Fly    66 MSNTDAQAAYITKVKALIAAVGL 88
            :|..||..|||:|.:.||...|:
Mouse    66 LSKEDAMCAYISKARELIEKYGI 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 44/82 (54%)
Acbd7NP_084339.1 ACBP 3..87 CDD:320831 44/84 (52%)
Acyl-CoA binding. {ECO:0000250} 30..34 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230513413
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 1 1.000 H82242
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T616706
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.