DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbd7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001165067.1 Gene:acbd7 XenbaseID:XB-GENE-5740466 Length:88 Species:Xenopus tropicalis

Alignment Length:88 Identity:50/89 (56%)
Similarity:61/89 (69%) Gaps:0/89 (0%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||...:|::||||||.|.|.|.|.:|.|||.||||:||||.|.|.||.||.|.||||:|||.:||
 Frog     1 MSPQADFDKAAEDVKKLKTRPTDEELKELYGLYKQSTVGDINIDCPGMLDLKAKAKWDAWNLKKG 65

  Fly    66 MSNTDAQAAYITKVKALIAAVGL 88
            :|..:|..|||:|...|:...||
 Frog    66 LSKEEAMHAYISKTNELVEKYGL 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 46/82 (56%)
acbd7NP_001165067.1 ACBP 4..87 CDD:238248 46/83 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230515253
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 1 1.000 H82242
Inparanoid 1 1.050 104 1.000 Inparanoid score I4694
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T1060484
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.