DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Acbd5

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001342566.1 Gene:Acbd5 / 74159 MGIID:1921409 Length:520 Species:Mus musculus


Alignment Length:69 Identity:28/69 - (40%)
Similarity:43/69 - (62%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKV 79
            ||.:..|.:..:|:.||.|||||.|.|...:|||.|..|:.||:||::...|:..:|..||:.::
Mouse    60 KNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEM 124

  Fly    80 KALI 83
            |.:|
Mouse   125 KKII 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 28/69 (41%)
Acbd5NP_001342566.1 ACBP 45..132 CDD:238248 28/69 (41%)

Return to query results.
Submit another query.