DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbd7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001122240.1 Gene:acbd7 ZFINID:ZDB-GENE-050913-108 Length:88 Species:Danio rerio

Alignment Length:82 Identity:51/83 (61%)
Similarity:59/83 (71%) Gaps:0/83 (0%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||:|.|||||.:.|.|.|.:||:||.|||||.|||.|.||||.:|.||||||:||::|||||..|
Zfish     6 EFDQYAEDVKKVKTRPTDQELLDLYGLYKQAVVGDINIDKPGMIDLKGKAKWDAWDSRKGMSTED 70

  Fly    71 AQAAYITKVKALIAAVG 87
            |..||||..|..|...|
Zfish    71 AMKAYITLAKQAIEKYG 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 50/81 (62%)
acbd7NP_001122240.1 ACBP 3..87 CDD:294152 50/81 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230513837
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 1 1.000 H82242
Inparanoid 1 1.050 109 1.000 Inparanoid score I4801
OMA 1 1.010
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T1053685
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.