DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and acbd7

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001122240.1 Gene:acbd7 / 619256 ZFINID:ZDB-GENE-050913-108 Length:88 Species:Danio rerio


Alignment Length:82 Identity:51/82 - (62%)
Similarity:59/82 - (71%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||:|.|||||.:.|.|.|.:||:||.|||||.|||.|.||||.:|.||||||:||::|||||..|
Zfish     6 EFDQYAEDVKKVKTRPTDQELLDLYGLYKQAVVGDINIDKPGMIDLKGKAKWDAWDSRKGMSTED 70

  Fly    71 AQAAYITKVKALIAAVG 87
            |..||||..|..|...|
Zfish    71 AMKAYITLAKQAIEKYG 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 50/80 (63%)
acbd7NP_001122240.1 ACBP 3..87 CDD:294152 50/80 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595708
Domainoid 1 1.000 108 1.000 Domainoid score I6414
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H82242
Inparanoid 1 1.050 109 1.000 Inparanoid score I4876
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - oto40735
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.