powered by:
Protein Alignment Acbp1 and Dbil5
DIOPT Version :9
| Sequence 1: | NP_001285744.1 |
Gene: | Acbp1 / 34111 |
FlyBaseID: | FBgn0031992 |
Length: | 90 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_067607.1 |
Gene: | Dbil5 / 59116 |
RGDID: | 68360 |
Length: | 87 |
Species: | Rattus norvegicus |
| Alignment Length: | 82 |
Identity: | 41/82 - (50%) |
| Similarity: | 47/82 - (57%) |
Gaps: | 1/82 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
||:: ||..|...:|.|.....|.:.|.:||.|||||.||||...|...|.|.|||||||...||
Rat 1 MSQV-EFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKG 64
Fly 66 MSNTDAQAAYITKVKAL 82
||..||...||.||:.|
Rat 65 MSKMDAMRIYIAKVEEL 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
1 |
1.010 |
- |
- |
|
QHG63566 |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1588000at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001211 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR23310 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.930 |
|
Return to query results.
Submit another query.