DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Dbil5

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_067607.1 Gene:Dbil5 RGDID:68360 Length:87 Species:Rattus norvegicus

Alignment Length:82 Identity:41/83 (49%)
Similarity:47/83 (57%) Gaps:1/83 (1%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||:: ||..|...:|.|.....|.:.|.:||.|||||.||||...|...|.|.|||||||...||
  Rat     1 MSQV-EFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKG 64

  Fly    66 MSNTDAQAAYITKVKAL 82
            ||..||...||.||:.|
  Rat    65 MSKMDAMRIYIAKVEEL 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 39/79 (49%)
Dbil5NP_067607.1 ACBP 2..85 CDD:238248 40/82 (49%)
Acyl-CoA binding. {ECO:0000250} 29..33 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.