DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbd5

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_012820025.1 Gene:acbd5 XenbaseID:XB-GENE-982910 Length:469 Species:Xenopus tropicalis

Alignment Length:69 Identity:32/70 (46%)
Similarity:46/70 (66%) Gaps:0/70 (0%)


  Fly    15 KNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKV 79
            ||.:..|.:..:|:.||.|||||:|.|||.:|||.|..|:.||:|||:...||..||..||:.::
 Frog    24 KNGSFQPSNEMMLKFYSFYKQATLGPCNTPRPGFWDPVGRYKWDAWNSLGDMSKEDAMIAYVDEM 88

  Fly    80 KALI 83
            |.::
 Frog    89 KKIL 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 32/70 (46%)
acbd5XP_012820025.1 ACBP 8..96 CDD:238248 32/70 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.