DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbd6

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001008065.2 Gene:acbd6 XenbaseID:XB-GENE-989234 Length:286 Species:Xenopus tropicalis

Alignment Length:81 Identity:40/82 (49%)
Similarity:47/82 (57%) Gaps:1/82 (1%)


  Fly     3 ELQ-EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGM 66
            ||| :|.|||:.|:|..:......||.||:.|||..||.|||.||||.|::||.|||||......
 Frog    31 ELQGQFEQAAKHVQNGASVASTEQLLFLYARYKQVKVGRCNTPKPGFFDYEGKKKWEAWKALGDY 95

  Fly    67 SNTDAQAAYITKVKAL 82
            |...|...||..||.|
 Frog    96 SCQQAMNEYIETVKKL 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 38/80 (48%)
acbd6NP_001008065.2 ACBP 35..113 CDD:279259 37/78 (47%)
Acyl-CoA binding. {ECO:0000250} 59..63 2/4 (50%)
ANK 156..261 CDD:238125
Ank_2 157..246 CDD:289560
ANK repeat 182..213 CDD:293786
ANK 1 182..211
ANK repeat 215..246 CDD:293786
ANK 2 215..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.