DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and eci2

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001002645.4 Gene:eci2 / 436918 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio


Alignment Length:84 Identity:35/84 - (41%)
Similarity:54/84 - (64%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGM 66
            :.:::||:|.:.:..|...||:...|::|:|:||||||.|||.|||.|||..|.||:||.....:
Zfish    38 ASVEDFNKAKDKLNTLKKDPGNEVKLKIYALFKQATVGPCNTPKPGMLDFVNKVKWDAWKGLGSI 102

  Fly    67 SNTDAQAAYITKVKALIAA 85
            |..||:..|:..:.:|:.|
Zfish   103 SQEDARQQYVDLISSLVGA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 35/81 (43%)
eci2NP_001002645.4 None

Return to query results.
Submit another query.