DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and ACBD7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001034933.1 Gene:ACBD7 HGNCID:17715 Length:88 Species:Homo sapiens

Alignment Length:83 Identity:49/84 (58%)
Similarity:59/84 (70%) Gaps:0/84 (0%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            :|::|||||:.|...|.|.:|.|||.|||||.|||.|...||.||.||||||||||.:||:|..|
Human     6 DFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED 70

  Fly    71 AQAAYITKVKALIAAVGL 88
            |.:|||:|.|.||...|:
Human    71 ATSAYISKAKELIEKYGI 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 48/81 (59%)
ACBD7NP_001034933.1 ACBP 3..87 CDD:320831 48/81 (59%)
Acyl-CoA binding 30..34 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230515464
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 1 1.000 H82242
Inparanoid 1 1.050 104 1.000 Inparanoid score I4873
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T609893
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.