DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and dbi

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_955902.1 Gene:dbi ZFINID:ZDB-GENE-040426-1861 Length:87 Species:Danio rerio

Alignment Length:88 Identity:52/89 (58%)
Similarity:63/89 (71%) Gaps:1/89 (1%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||| .||.:|||:||.|...|.|.::||:|||||||||||.||.:||.|||.|||||:||:.:||
Zfish     1 MSE-AEFQKAAEEVKQLKAKPTDAEMLEIYSLYKQATVGDVNTARPGMLDFTGKAKWDAWDAKKG 64

  Fly    66 MSNTDAQAAYITKVKALIAAVGL 88
            .|..||..|||.||:.|....|:
Zfish    65 TSKEDAVKAYIAKVEELKGKYGI 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 48/82 (59%)
dbiNP_955902.1 ACBP 2..86 CDD:294152 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4801
OMA 1 1.010
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 LDO PTHR23310
Phylome 1 0.910 0.607 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.