DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbp-7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001033359.2 Gene:acbp-7 WormBaseID:WBGene00044603 Length:134 Species:Caenorhabditis elegans

Alignment Length:100 Identity:26/100 (26%)
Similarity:40/100 (40%) Gaps:27/100 (27%)


  Fly    10 AAEDVKNLNT---------------TPGDNDLLELYSLYKQATVGDCNTDKPGFLD--------- 50
            |.||.|.:..               |..:|....::.||:||.|||.|..|..:::         
 Worm     4 ALEDFKRIRAQFVQRKVLKYEFELFTKFENHTRHVWGLYQQAIVGDVNVPKLNYMEIDEGEKSWM 68

  Fly    51 ---FKGKAKWEAWNNRKGMSNTDAQAAYITKVKAL 82
               ..|..||.|||..:|::..:|...|:..|:.|
 Worm    69 WRWINGNEKWHAWNKCRGLTKEEASEQYVEAVQKL 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 26/100 (26%)
acbp-7NP_001033359.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.