DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbp2

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_523952.2 Gene:Acbp2 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster

Alignment Length:80 Identity:47/81 (58%)
Similarity:61/81 (75%) Gaps:0/81 (0%)


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            ::||.|||.||:|...|.|::.|:||:|:|||:|||.:|.|||.||.||||||||||.:||.|:.
  Fly     4 EQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSE 68

  Fly    70 DAQAAYITKVKALIA 84
            .||..|||.|:.|:|
  Fly    69 AAQQEYITFVEGLVA 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 47/81 (58%)
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 47/81 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108775921
eggNOG 1 0.900 E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I2268
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 P PTHR23310
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
87.920

Return to query results.
Submit another query.