DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbp6

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001286963.1 Gene:Acbp6 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster

Alignment Length:74 Identity:31/75 (41%)
Similarity:43/75 (57%) Gaps:2/75 (3%)


  Fly     7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
            |.:..|..||....|...:.||.|..||||||||||.::|.  |.:.||::.||.::.|::..||
  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66

  Fly    72 QAAYITKVK 80
            :|.||...|
  Fly    67 KAYYIEVYK 75

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 31/75 (41%)
Acbp6NP_001286963.1 ACBP 4..79 CDD:307165 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 P PTHR23310
RoundUp 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.