DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbp4

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_648081.1 Gene:Acbp4 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster

Alignment Length:70 Identity:39/71 (55%)
Similarity:48/71 (68%) Gaps:0/71 (0%)


  Fly     7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
            |.:|||..||.:..|.|::.||.|.|:|||||||.|.||||.||.|.||.:||||..||:|...|
  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68

  Fly    72 QAAYI 76
            :.||:
  Fly    69 KEAYV 73

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 39/71 (55%)
Acbp4NP_648081.1 ACBP 4..81 CDD:279259 39/71 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I2268
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 P PTHR23310
RoundUp 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.