DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbd7

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001119551.1 Gene:Acbd7 RGDID:1564164 Length:89 Species:Rattus norvegicus

Alignment Length:89 Identity:47/90 (52%)
Similarity:60/90 (67%) Gaps:1/90 (1%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDK-PGFLDFKGKAKWEAWNNRK 64
            ||...:|:|||:||:.|.:.|.|.:|.|||.||||:.:||.|... |..||.||||||||||.:|
  Rat     1 MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIGACPAMLDLKGKAKWEAWNLQK 65

  Fly    65 GMSNTDAQAAYITKVKALIAAVGL 88
            |:|..||..|||:|.:.||...|:
  Rat    66 GLSKEDAMGAYISKARELIEKYGI 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 44/83 (53%)
Acbd7NP_001119551.1 ACBP 3..88 CDD:294152 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230513593
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 1 1.000 H82242
Inparanoid 1 1.050 98 1.000 Inparanoid score I4854
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T131176
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.