DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and acbd6

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001020626.1 Gene:acbd6 / 324090 ZFINID:ZDB-GENE-030131-2810 Length:300 Species:Danio rerio


Alignment Length:77 Identity:37/77 - (48%)
Similarity:45/77 - (58%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||..||:.|::|..|.....||.||:.:||..||.|||.||||.||:|:.||.||.....||...
Zfish    63 EFESAADRVRDLVQTASREQLLYLYARFKQVKVGKCNTSKPGFFDFEGQRKWSAWKQLGDMSAEQ 127

  Fly    71 AQAAYITKVKAL 82
            |...|:|.|.||
Zfish   128 AMQEYVTCVHAL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 37/77 (48%)
acbd6NP_001020626.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
ACBP 61..141 CDD:279259 37/77 (48%)
Acyl-CoA binding. /evidence=ECO:0000250 87..91 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..162
ANK 183..279 CDD:238125
Ank_2 184..273 CDD:289560
ANK repeat 209..240 CDD:293786
ANK 1 209..238
ANK repeat 242..273 CDD:293786
ANK 2 242..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.