DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and acbd6

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001020626.1 Gene:acbd6 / 324090 ZFINID:ZDB-GENE-030131-2810 Length:300 Species:Danio rerio


Alignment Length:77 Identity:37/77 - (48%)
Similarity:45/77 - (58%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||..||:.|::|..|.....||.||:.:||..||.|||.||||.||:|:.||.||.....||...
Zfish    63 EFESAADRVRDLVQTASREQLLYLYARFKQVKVGKCNTSKPGFFDFEGQRKWSAWKQLGDMSAEQ 127

  Fly    71 AQAAYITKVKAL 82
            |...|:|.|.||
Zfish   128 AMQEYVTCVHAL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 37/77 (48%)
acbd6NP_001020626.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
ACBP 61..133 CDD:459982 32/69 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..162
ANKYR <184..>279 CDD:440430
ANK repeat 209..240 CDD:293786
ANK 1 209..238
ANK repeat 242..273 CDD:293786
ANK 2 242..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..300
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.