DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Acbd4

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_008766506.1 Gene:Acbd4 / 303577 RGDID:1308404 Length:337 Species:Rattus norvegicus


Alignment Length:84 Identity:35/84 - (41%)
Similarity:51/84 - (60%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QEFNQAAEDVKNL----NTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ::|..|...::||    :..|...::|..||.|||||.|.|...:|||.|..|:.||:|||:...
  Rat    12 KQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGK 76

  Fly    66 MSNTDAQAAYITKVKALIA 84
            ||..:|.:||||::| |:|
  Rat    77 MSREEAMSAYITEMK-LVA 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 35/84 (42%)
Acbd4XP_008766506.1 ACBP 11..91 CDD:279259 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.