powered by:
Protein Alignment Acbp1 and Acbd4
DIOPT Version :9
| Sequence 1: | NP_001285744.1 |
Gene: | Acbp1 / 34111 |
FlyBaseID: | FBgn0031992 |
Length: | 90 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_008766506.1 |
Gene: | Acbd4 / 303577 |
RGDID: | 1308404 |
Length: | 337 |
Species: | Rattus norvegicus |
| Alignment Length: | 84 |
Identity: | 35/84 - (41%) |
| Similarity: | 51/84 - (60%) |
Gaps: | 5/84 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 QEFNQAAEDVKNL----NTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
::|..|...::|| :..|...::|..||.|||||.|.|...:|||.|..|:.||:|||:...
Rat 12 KQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGK 76
Fly 66 MSNTDAQAAYITKVKALIA 84
||..:|.:||||::| |:|
Rat 77 MSREEAMSAYITEMK-LVA 94
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Acbp1 | NP_001285744.1 |
ACBP |
5..87 |
CDD:238248 |
35/84 (42%) |
| Acbd4 | XP_008766506.1 |
ACBP |
11..91 |
CDD:279259 |
32/78 (41%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.