DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Eci2

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 RGDID:1359427 Length:391 Species:Rattus norvegicus

Alignment Length:78 Identity:35/79 (44%)
Similarity:43/79 (54%) Gaps:0/79 (0%)


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            |:|..|...||.|...||:...|.||:||||||.|.|...|||..||..||||:|||....:...
  Rat    39 QDFENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKE 103

  Fly    70 DAQAAYITKVKAL 82
            .|:..|:..|.:|
  Rat   104 TARQNYVDLVSSL 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 35/79 (44%)
Eci2NP_001006967.1 ACBP 38..113 CDD:279259 33/74 (45%)
Acyl-CoA binding. {ECO:0000250} 64..68 3/4 (75%)
crotonase-like 134..389 CDD:304874
ECH-like 149..319
Substrate binding. {ECO:0000250|UniProtKB:Q05871} 196..200
Microbody targeting signal. {ECO:0000255} 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.