DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Acbd6

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001011906.1 Gene:Acbd6 RGDID:1305030 Length:282 Species:Rattus norvegicus

Alignment Length:82 Identity:37/83 (45%)
Similarity:45/83 (54%) Gaps:2/83 (2%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ::||  |.:||..|:.|........||.||:.|||..||:||..||.|.||:||.|||||.....
  Rat    42 LAEL--FEKAAAHVQGLVQVASREQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWKALGD 104

  Fly    66 MSNTDAQAAYITKVKAL 82
            .|.:.|...||..||.|
  Rat   105 SSPSQAMQEYIAAVKKL 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 35/79 (44%)
Acbd6NP_001011906.1 ACBP 44..123 CDD:279259 37/81 (46%)
Acyl-CoA binding. {ECO:0000250} 69..73 2/4 (50%)
ANK 165..261 CDD:238125
Ank_2 166..255 CDD:289560
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.