DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Acbd6

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001011906.1 Gene:Acbd6 / 289125 RGDID:1305030 Length:282 Species:Rattus norvegicus


Alignment Length:82 Identity:37/82 - (45%)
Similarity:45/82 - (54%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ::||  |.:||..|:.|........||.||:.|||..||:||..||.|.||:||.|||||.....
  Rat    42 LAEL--FEKAAAHVQGLVQVASREQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWKALGD 104

  Fly    66 MSNTDAQAAYITKVKAL 82
            .|.:.|...||..||.|
  Rat   105 SSPSQAMQEYIAAVKKL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 35/78 (45%)
Acbd6NP_001011906.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
ACBP 43..118 CDD:459982 34/76 (45%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.