DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and SPBC1539.06

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_596820.1 Gene:SPBC1539.06 PomBaseID:SPBC1539.06 Length:87 Species:Schizosaccharomyces pombe

Alignment Length:83 Identity:47/84 (56%)
Similarity:56/84 (67%) Gaps:0/84 (0%)


  Fly     7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
            |.|||.|||.|..||..::||:||:|:|||||||.||:|||.||.|||.||.||...||.|..||
pombe     5 FEQAAADVKELKETPNSDELLKLYALFKQATVGDNNTEKPGLLDLKGKFKWNAWEELKGKSKEDA 69

  Fly    72 QAAYITKVKALIAAVGLK 89
            .:.||:.|..|....|:|
pombe    70 ASEYISFVDELKTKYGMK 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 45/80 (56%)
SPBC1539.06NP_596820.1 ACB 1..86 CDD:226731 46/81 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127366
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.