DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Eci2

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001103801.1 Gene:Eci2 / 23986 MGIID:1346064 Length:391 Species:Mus musculus


Alignment Length:78 Identity:37/78 - (47%)
Similarity:45/78 - (57%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            |:|..|...||.|...||:...|.||:||||||.|.||..|||.|||..||||:|||....:...
Mouse    39 QDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNALGSLPKE 103

  Fly    70 DAQAAYITKVKAL 82
            .|:..|:..|.:|
Mouse   104 TARQNYVDLVSSL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 37/78 (47%)
Eci2NP_001103801.1 ACBP 38..113 CDD:459982 35/73 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136 1/1 (100%)
CaiD 140..389 CDD:440647
ECH-like 149..319
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.